PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00633g02008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family NF-YB
Protein Properties Length: 149aa    MW: 16962.9 Da    PI: 4.7718
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00633g02008.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB149.37.8e-47699497
                     NF-YB  4 qdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90
                               ++++P+anv+rimk++lP  akisk+aket+qec+sefisfvt+easdkc++e+r+t+ngdd++wal++lGf+ y+e++  yl k 
  Peinf101Scf00633g02008.1  6 VNKLVPVANVGRIMKQILPPTAKISKEAKETMQECASEFISFVTGEASDKCHKENRRTVNGDDICWALSSLGFDTYAEAMIRYLYKL 92
                              5899*********************************************************************************** PP

                     NF-YB 91 relegek 97
                              re+e+++
  Peinf101Scf00633g02008.1 93 REFERQR 99
                              ****986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.46E-359122IPR009072Histone-fold
Gene3DG3DSA:1.10.20.101.1E-449125IPR009072Histone-fold
PfamPF008081.3E-251073IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006156.0E-163755No hitNo description
PROSITE patternPS0068504056IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006156.0E-165674No hitNo description
PRINTSPR006156.0E-167593No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MVDEHVNKLV PVANVGRIMK QILPPTAKIS KEAKETMQEC ASEFISFVTG EASDKCHKEN  60
RRTVNGDDIC WALSSLGFDT YAEAMIRYLY KLREFERQRA NQSKGSINDD EDTDDEATSE  120
SEKQETTLSP PAPLEYFNLK SKYFHQTTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B2e-36794592Transcription factor HapC (Eurofung)
4g91_B2e-36794592Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009760265.19e-77PREDICTED: nuclear transcription factor Y subunit B-4-like
RefseqXP_016458099.19e-77PREDICTED: nuclear transcription factor Y subunit B-4-like
SwissprotO040271e-51NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBLK4B0W99e-68K4B0W9_SOLLC; Uncharacterized protein
STRINGSolyc01g099320.2.13e-67(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.12e-52nuclear factor Y, subunit B4